PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G20610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 412aa    MW: 44336.6 Da    PI: 6.5152
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G20610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed+llv+ v+++G g+W+++ r+ g+ R++k+c++rw ++l
  LPERR06G20610.1 14 KGPWTQGEDKLLVEHVRRHGEGNWNAVRRETGLQRCGKSCRLRWANHL 61
                     79******************************************9986 PP

2Myb_DNA-binding42.91.1e-1367110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++ E+  +++++++lG++ W++I++++  gRt++++k++w++
  LPERR06G20610.1  67 KGPFSPLEERTILRLHALLGNK-WARISSYLR-GRTDNEIKNYWNT 110
                      79********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.074961IPR017930Myb domain
SuperFamilySSF466893.63E-2911108IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-211164IPR009057Homeodomain-like
SMARTSM007175.9E-131363IPR001005SANT/Myb domain
PfamPF002491.5E-141461IPR001005SANT/Myb domain
CDDcd001672.92E-111661No hitNo description
PROSITE patternPS0017502938IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129422.77262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2265116IPR009057Homeodomain-like
SMARTSM007178.2E-1466114IPR001005SANT/Myb domain
PfamPF002494.4E-1367110IPR001005SANT/Myb domain
CDDcd001676.63E-1069110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MARSGGEGGG GLKKGPWTQG EDKLLVEHVR RHGEGNWNAV RRETGLQRCG KSCRLRWANH  60
LRPNLRKGPF SPLEERTILR LHALLGNKWA RISSYLRGRT DNEIKNYWNT RMKRRVRAGM  120
AVYPPEVERE IAELRAQNAN LSSAPAVDGD GNVCIPPSLL LDISSSPFAF PSPATASGLG  180
SPVINQNYPL LNQMSLLHLA NNQQQPAFHH DAAGHGGGGG FVSSGLPPLP TRPAREIHSN  240
QFEITVASGG GGGDDDGLLD SLLLLGDDGL LPPPAPRPNT AMLRVGSMPE LMYREPSSRI  300
VIHGGGGGDS DVTSQYPPGE EDPHFGGRWD FVFDDVKPSK RKAASAVEED ISGMFGINPG  360
SIPGEWFAAG AGSSAPSPGP SSVVTDDDFS LEMQQFMSSL PLLPSEEHQW NT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1116971e-95AK111697.1 Oryza sativa Japonica Group cDNA clone:J023004F23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641592.11e-171PREDICTED: uncharacterized protein LOC4341850
TrEMBLA0A0D9WT990.0A0A0D9WT99_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g46560.11e-170(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123972632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.22e-55myb domain protein 101